PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010932188.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 578aa    MW: 64135.8 Da    PI: 4.4311
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010932188.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.36.1e-53371632128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppGfrFhPtdeelv +yLk+kv +++l+l  +i +vd+yk+ePw+Lp k  +k+++k+wyfFs+rd+ky++g+r+nr+tk+gyWk+tgkd+++ +
  XP_010932188.1  37 PPGFRFHPTDEELVLYYLKRKVCRRRLRL-PMIGDVDVYKCEPWELPeKsVLKSGDKQWYFFSPRDRKYPNGSRSNRTTKHGYWKTTGKDRTISQ 130
                     8*************************999.88**************96357788999************************************99 PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg kktLv+++grap+ge+tdWvmhey+l
  XP_010932188.1 131 -NSKAVGNKKTLVYHRGRAPRGERTDWVMHEYTL 163
                     .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6034186IPR003441NAC domain
PROSITE profilePS5100555.73236186IPR003441NAC domain
PfamPF023652.1E-2737163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MGAAPECRRP TGRSGCDDGI EDEGAVGAAL GNPKCWPPGF RFHPTDEELV LYYLKRKVCR  60
RRLRLPMIGD VDVYKCEPWE LPEKSVLKSG DKQWYFFSPR DRKYPNGSRS NRTTKHGYWK  120
TTGKDRTISQ NSKAVGNKKT LVYHRGRAPR GERTDWVMHE YTLDEQLLMS CNKVQDCYAL  180
YKVFRKSGPG PKNGEQYGAP FREEEWEDDG ENDSSRNQNS KECTASEHPD SATSTGMLGD  240
EGSRLPMDDL EDFLLQLSNE QDIIPQPSKH SAYVSEIDAE AEVGSHTEVP CLVDANFTEQ  300
NFNWCELSGE EPNSEITMPD PACMQPVKDR VITSISTCSD QDQFRDDEEF LEIKDFNDPE  360
SVEWRVDDVS NKDIVHDTGG LYDSYDYFDA PMYLAEEFEP LDGAGQNPYF YEDQASHITS  420
ELWTFEQDFG VATAAESNDV IIAPPASGVV YASTPSNPGE NTQGQISPFG GASDSWFSSA  480
LSSLLDSVPS SPALASENAL ISRALQRVSS FRAGPIGAQE PNGTTGGGTL ASGRQRESHN  540
GGFLFISFLV GLVAIFWVLT IGAALKIFKG LWGKFISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-493716316140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932188.10.0PREDICTED: uncharacterized protein LOC105052904 isoform X1
TrEMBLM0TT810.0M0TT81_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P24280_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1851269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.17e-83NAC domain containing protein 17